GPR172B Human Recombinant Protein (P01)
For Research Use Only. Not For Clinical Use.
Catalog Number: Hum0011
Host: Wheat Germ (in vitro)
| Product Size | Price |
|---|---|
| 10 μg | Online Inquiry |
| 25 μg | Online Inquiry |
Applications
- Applications:
- Enzyme-Linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Prtein Array
Specification
- Description:
- GPR172B Human Recombinant Protein (P01) is human GPR172B full-length ORF (1 a.a. - 448 a.a.) recombinant protein with GST-tag at N-terminal.
- Molecular Weight (kDa):
- 72.8 (Theoretical)
- Sequence:
- MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRRLAPGKGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPERFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEVHQLFSAHGAFLLGLMAFTSAVTNGVLPSVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMALAILSPCPPLVGTTAGVVLVVLSWVLCLCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGAGAMFPPTSIYHVFQSRKDCVDPCGP
- Purification:
- Glutathione Sepharose 4 Fast Flow
- Storage Buffer:
- 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
- Storage:
-
Store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- GPR172B
- Gene Description:
- GPR172B (G Protein-Coupled Receptor 172B) is a Protein Coding gene. Biological redox reactions require electron donors and acceptor. Vitamin B2 is the source for the flavin in flavin adenine dinucleotide (FAD) and flavin mononucleotide (FMN) which are common redox reagents. This gene encodes a member of the riboflavin (vitamin B2) transporter family. Haploinsufficiency of this protein can cause maternal riboflavin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jan 2013]
- GenBank Accession Number:
- NM_017986.2
- Protein Accession Number:
- NP_060456.2