ADCYAP1R1 Mouse Monoclonal Antibody (M01)

ADCYAP1R1 Mouse Monoclonal Antibody (M01)

For Research Use Only. Not For Clinical Use.

Catalog Number: MAB-M0001

Host: Mouse

Reactivity: Human

Product Size Price
100 μg Online Inquiry

Applications

  • Applications:
  • Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

  • Clone:
  • 2B12
  • Description:
  • ADCYAP1R1 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant protein ADCYAP1R1 (21 a.a. - 120 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
  • Isotype:
  • IgG1 kappa
  • Molecular Weight (kDa):
  • 36.74 (Immunogen)
  • Sequence:
  • MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
  • Storage Buffer:
  • In 1× PBS, pH 7.4
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • ADCYAP1R1
  • Gene Description:
  • ADCYAP1R1 (adenylate cyclase activating polypeptide 1 (pituitary) receptor typeⅠ) is a protein coding gene, which encodes typeⅠadenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Dec 2010]
  • GenBank Accession Number:
  • NM_001118
  • Protein Accession Number:
  • NP_001109