Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 7B8

• Description:
• AVPR1A Mouse Monoclonal Antibody (M07A) is raised against a partial recombinant AVPR1A (1 a.a. - 52 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG1 kappa

• Molecular Weight (kDa):
• 31.46 (Immunogen)

• Sequence:
• MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAK

• Storage Buffer:
• In ascites fluid

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• AVPR1A

• Gene Description:
• AVPR1A (Arginine Vasopressin Receptor 1A) is a protein coding gene. The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor mediates cell contraction and proliferation, platelet aggregation, release of coagulation factor and glycogenolysis. [provided by RefSeq, Jul 2008]

• GenBank Accession Number:
• NM_000706

• Protein Accession Number:
• NP_000697