Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 3F6

• Description:
• BDKRB2 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant BDKRB2 (1 a.a. - 60 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG1 lambda

• Molecular Weight (kDa):
• 32.34 (Immunogen)

• Sequence:
• MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• BDKRB2

• Gene Description:
• BDKRB2 (Bradykinin Receptor B2) is a protein coding gene, which encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. Bradykinin is released upon activation by pathophysiologic conditions such as trauma and inflammation, and binds to its kinin receptors, B1 and B2. The B2 receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein. [provided by RefSeq, Jan 2020]

• GenBank Accession Number:
• NM_000623

• Protein Accession Number:
• NP_000614