CALCR Mouse Monoclonal Antibody (M01)

CALCR Mouse Monoclonal Antibody (M01)

For Research Use Only. Not For Clinical Use.

Catalog Number: MAB-M0013

Host: Mouse

Reactivity: Human

Product Size Price
100 μg Online Inquiry

Applications

  • Applications:
  • Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

  • Clone:
  • 2F7
  • Description:
  • CALCR Mouse Monoclonal Antibody (M01) is raised against a partial recombinant CALCR (394 a.a. - 474 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
  • Isotype:
  • IgG2a kappa
  • Molecular Weight (kDa):
  • 34.65 (Immunogen)
  • Sequence:
  • CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA
  • Storage Buffer:
  • In 1× PBS, pH 7.4
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • CALCR
  • Gene Description:
  • CALCR (Calcitonin Receptor) is a protein coding gene, which encodes a high affinity receptor for the peptide hormone calcitonin and belongs to a subfamily of seven transmembrane-spanning G protein-coupled receptors. The encoded protein is involved in maintaining calcium homeostasis and in regulating osteoclast-mediated bone resorption. Polymorphisms in this gene have been associated with variations in bone mineral density and onset of osteoporosis. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]
  • GenBank Accession Number:
  • NM_001742
  • Protein Accession Number:
  • NP_001733.1