CASR Mouse Monoclonal Antibody (M01)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Enzyme-Linked Immunoabsorbent Assay
Specification
- Clone:
- 3F12
- Description:
- CASR Mouse Monoclonal Antibody (M01) is raised against a partial recombinant CASR (21 a.a. - 120 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Isotype:
- IgG2a kappa
- Sequence:
- GPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKI
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- CASR
- Gene Description:
-
CASR (Calcium Sensing Receptor) is a protein coding gene. The protein encoded by this gene is a plasma membrane G protein-coupled receptor that senses small changes in circulating calcium concentration. The encoded protein couples this information to intracellular signaling pathways that modify parathyroid hormone secretion or renal cation handling, and thus this protein plays an essential role in maintaining mineral ion homeostasis. Mutations in this gene are a cause of familial hypocalciuric hypercalcemia, neonatal severe hyperparathyroidism, and autosomal dominant hypocalcemia. [provided by RefSeq, Aug 2017]
- GenBank Accession Number:
- NM_000388
- Protein Accession Number:
- NP_000379