CCR5 Purified Mouse Polyclonal Antibody (B02P)

CCR5 Purified Mouse Polyclonal Antibody (B02P)

For Research Use Only. Not For Clinical Use.

Catalog Number: PAB-M0025

Host: Mouse

Reactivity: Human

Product Size Price
50 μg Online Inquiry

Applications

  • Applications:
  • Flow Cytometry, Western Blot

Specification

  • Description:
  • CCR5 Purified Mouse Polyclonal Antibody (B02P) is raised against a full-length human CCR5 protein (1 a.a. - 352 a.a.).
  • Molecular Weight (kDa):
  • 40.05 (Transfected lysate)
  • Sequence:
  • MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
  • Storage Buffer:
  • In 1× PBS, pH 7.4
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • CCR5
  • Gene Description:
  • CCR5 (C-C Motif Chemokine Receptor 5 (Gene/Pseudogene)) is a Protein Coding gene. This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this gene was also detected in a promyeloblastic cell line, suggesting that this protein may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. An allelic polymorphism in this gene results in both functional and non-functional alleles; the reference genome represents the functional allele. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2015]
  • GenBank Accession Number:
  • NM_000579
  • Protein Accession Number:
  • NP_000570