CCRL2 Purified Mouse Polyclonal Antibody (B02P)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Flow Cytometry, Western Blot
Specification
- Description:
- CCRL2 Purified Mouse Polyclonal Antibody (B02P) is raised against a full-length human CCRL2 protein (1 a.a. - 344 a.a.).
- Molecular Weight (kDa):
- 37.84 (Transfected lysate)
- Sequence:
- MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- CCRL2
- Gene Description:
- CCRL2 (C-C Motif Chemokine Receptor Like 2) is a Protein Coding gene. This gene encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. This gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown. This gene is mapped to the region where the chemokine receptor gene cluster is located. [provided by RefSeq, Jul 2008]
- GenBank Accession Number:
- NM_003965
- Protein Accession Number:
- NP_003956