Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Description:
• CHRM3 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant CHRM3 (1 a.a. - 67 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Molecular Weight (kDa):
• 33.48 (Immunogen)

• Sequence:
• MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQ

• Storage Buffer:
• 50% glycerol

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• CHRM3

• Gene Description:
• CHRM3 (Cholinergic Receptor Muscarinic 3) is a Protein Coding gene. The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 3 controls smooth muscle contraction and its stimulation causes secretion of glandular tissue. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities. [provided by RefSeq, Dec 2016]

• GenBank Accession Number:
• NM_000740

• Protein Accession Number:
• NP_000731