Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Description:
• CYSLTR1 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant CYSLTR1 (248 a.a. - 337 a.a.).

• Molecular Weight (kDa):
• 35.9 (Immunogen)

• Sequence:
• PYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV

• Storage Buffer:
• 50% glycerol

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• CYSLTR1

• Gene Description:
• CYSLTR2 (Cysteinyl Leukotriene Receptor 2) is a Protein Coding gene. The cysteinyl leukotrienes LTC4, LTD4, and LTE4 are important mediators of human bronchial asthma. Pharmacologic studies have determined that cysteinyl leukotrienes activate at least 2 receptors, the protein encoded by this gene and CYSLTR1. This encoded receptor is a member of the superfamily of G protein-coupled receptors. It seems to play a major role in endocrine and cardiovascular systems. [provided by RefSeq, Jul 2008]

• GenBank Accession Number:
• BC035750

• Protein Accession Number:
• AAH35750