Applications

• Applications:
• Enzyme-Linked Immunoabsorbent Assay

Specification

• Description:
• EDNRA Mouse Polyclonal Antibody (A01) is raised against a partial recombinant EDNRA (18 a.a. - 80 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Sequence:
• VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK

• Storage Buffer:
• 50% glycerol

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• EDNRA

• Gene Description:
• EDNRA (Endothelin Receptor Type A) is a protein coding gene. This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

• GenBank Accession Number:
• BC022511

• Protein Accession Number:
• AAH22511