Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Description:
• ELTD1 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant ELTD1 (333 a.a. - 432 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Molecular Weight (kDa):
• 37.11 (Immunogen)

• Sequence:
• TEFVKTVNNFVQRDTFVVWDKLSVNHRRTHLTKLMHTVEQATLRISQSFQKTTEFDTNSTDIALKVFFFDSYNMKHIHPHMNMDGDYINIFPKRKAAYDS

• Storage Buffer:
• 50% glycerol

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• ELTD1

• Gene Description:
• ELTD1 (EGF, latrophilin and seven transmembrane domain containing 1) is a Protein Coding gene, which encodes a latrophilin-like orphan receptor of the adhesion G protein-coupled receptor family. This receptor is related to angiogenesis.

• GenBank Accession Number:
• XM_371262

• Protein Accession Number:
• XP_371262