FZD2 Mouse Polyclonal Antibody (A01)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Enzyme-Linked Immunoabsorbent Assay
Specification
- Description:
- FZD2 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant FZD2 (192 a.a. - 245 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Molecular Weight (kDa):
- 32.05 (Immunogen)
- Sequence:
- YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR
- Storage Buffer:
- 50% glycerol
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- FZD2
- Gene Description:
-
FZD2 (Frizzled Class Receptor 2) is a protein coding gene. This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. This gene encodes a protein that is coupled to the beta-catenin canonical signaling pathway. Competition between the wingless-type MMTV integration site family, member 3A and wingless-type MMTV integration site family, member 5A gene products for binding of this protein is thought to regulate the beta-catenin-dependent and -independent pathways. [provided by RefSeq, Dec 2010]
- GenBank Accession Number:
- NM_001466
- Protein Accession Number:
- NP_001457