Applications

• Applications:
• Enzyme-Linked Immunoabsorbent Assay

Specification

• Description:
• FZD6 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant FZD6 (71 a.a. - 181 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Sequence:
• PNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQC

• Storage Buffer:
• 50% glycerol

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• FZD6

• Gene Description:
• FZD6 (Frizzled Class Receptor 6) is a Protein Coding gene. This gene represents a member of the 'frizzled' gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The protein encoded by this family member contains a signal peptide, a cysteine-rich domain in the N-terminal extracellular region, and seven transmembrane domains, but unlike other family members, this protein does not contain a C-terminal PDZ domain-binding motif. This protein functions as a negative regulator of the canonical Wnt/beta-catenin signaling cascade, thereby inhibiting the processes that trigger oncogenic transformation, cell proliferation, and inhibition of apoptosis. Alternative splicing results in multiple transcript variants, some of which do not encode a protein with a predicted signal peptide.[provided by RefSeq, Aug 2011]

• GenBank Accession Number:
• NM_003506

• Protein Accession Number:
• NP_003497