FZD8 Mouse Polyclonal Antibody (A01)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Enzyme-Linked Immunoabsorbent Assay
Specification
- Description:
- FZD8 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant FZD8 (72 a.a. - 161 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Molecular Weight (kDa):
- 36.01 (Immunogen)
- Sequence:
- FWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAP
- Storage Buffer:
- 50% glycerol
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- FZD8
- Gene Description:
- FZD8 (Frizzled Class Receptor 8) is a Protein Coding gene. This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This gene is highly expressed in two human cancer cell lines, indicating that it may play a role in several types of cancer. The crystal structure of the extracellular cysteine-rich domain of a similar mouse protein has been determined. [provided by RefSeq, Jul 2008]
- GenBank Accession Number:
- NM_031866
- Protein Accession Number:
- NP_114072