Applications

• Applications:
• Flow Cytometry, Western Blot

Specification

• Description:
• GLIPR1L1 Purified Mouse Polyclonal Antibody (B03P) is raised against a full-length human GLIPR1L1 protein (1 a.a. - 233 a.a.).

• Molecular Weight (kDa):
• 25.63 (Transfected lysate)

• Sequence:
• MALKNKFSCLWILGLCLVATTSSKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFLLLRIF

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• GLIPR1L1

• Gene Description:
• GLIPR1L1 (GLIPR1 Like 1) is a Protein Coding gene. It is involved in the binding between sperm and oocytes.

• GenBank Accession Number:
• NM_152779

• Protein Accession Number:
• NP_689992.1