Applications

• Applications:
• Western Blot, Enzyme-Linked-Immunoabsorbent Assay

Specification

• Description:
• GNRHR2 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant GNRHR2 (237 a.a. - 292 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Molecular Weight (kDa):
• 32.27 (Immunogen)

• Sequence:
• TLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI

• Storage Buffer:
• 50% glycerol

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• GNRHR2

• Gene Description:
• GNRHR2 (Gonadotropin Releasing Hormone Receptor 2 (Pseudogene)) is a pseudogene. In non-hominoid primates and non-mammalian vertebrates, the gonadotropin releasing hormone 2 receptor gene (GnRHR2) encodes a seven-transmembrane G-protein coupled receptor. However, in human, the corresponding reading frame contains a premature stop codon, which has been suggested to encode a selenocysteine residue, but there is no solid evidence for selenocysteine incorporation (PMID: 12538601). It appears that the human GnRHR2 transcription occurs but the gene does not likely produce a functional multi-transmembrane protein. A non-transcribed pseudogene of GnRHR2 is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2013]

• GenBank Accession Number:
• NM_057163

• Protein Accession Number:
• NP_001457