GPR1 Purified Mouse Polyclonal Antibody (B01P)

GPR1 Purified Mouse Polyclonal Antibody (B01P)

For Research Use Only. Not For Clinical Use.

Catalog Number: PAB-M0062

Host: Mouse

Reactivity: Human

Product Size Price
50 μg Online Inquiry

Applications

  • Applications:
  • Western Blot

Specification

  • Description:
  • GPR1 Purified Mouse Polyclonal Antibody (B01P) is raised against a full-length human GPR1 protein (1 a.a. - 355 a.a.).
  • Molecular Weight (kDa):
  • 41.4 (Transfected lysate)
  • Sequence:
  • MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ
  • Storage Buffer:
  • In 1× PBS, pH 7.4
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • GPR1
  • Gene Description:
  • GPR1 (G Protein-Coupled Receptor 1) is a Protein Coding gene, which encodes the receptor for the inflammation-associated leukocyte chemoattractant chemerin/RARRES2. This receptor plays a role in the regulation of inflammation.
  • GenBank Accession Number:
  • NM_005279
  • Protein Accession Number:
  • NP_005270.2