GPR1 Purified Mouse Polyclonal Antibody (B01P)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot
Specification
- Description:
- GPR1 Purified Mouse Polyclonal Antibody (B01P) is raised against a full-length human GPR1 protein (1 a.a. - 355 a.a.).
- Molecular Weight (kDa):
- 41.4 (Transfected lysate)
- Sequence:
- MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- GPR1
- Gene Description:
- GPR1 (G Protein-Coupled Receptor 1) is a Protein Coding gene, which encodes the receptor for the inflammation-associated leukocyte chemoattractant chemerin/RARRES2. This receptor plays a role in the regulation of inflammation.
- GenBank Accession Number:
- NM_005279
- Protein Accession Number:
- NP_005270.2