Applications

• Applications:
• Western Blot

Specification

• Description:
• GPR110 Purified Mouse Polyclonal Antibody (B01P) is raised against a full-length human GPR110 protein (1 a.a. - 218 a.a.).

• Molecular Weight (kDa):
• 23.98 (Transfected lysate)

• Sequence:
• MKVGVLWLISFFTFTDGHGGFLGKNDGIKTKKELIVNKKKHLGPVEEYQLLLQVTYRDSKEKRDLRNFLKLLKPPLLWSHGLIRIIRAKATTDCNSLNGVLQCTCEDSYTWFPPSCLDPQNCYLHTAGALPSCECHLNNLSQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYANGIEIQLKKAYERIQGFESVQVTQFRMSLLSPKLECNGTI

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• GPR110

• Gene Description:
• GPR110 (G Protein-Coupled Receptor 110) is a protein coding gene, which encodes a receptor belonging to the adhesion-GPCR receptor family.

• GenBank Accession Number:
• NM_025048

• Protein Accession Number:
• NP_079324.2