GPR110 Purified Mouse Polyclonal Antibody (B01P)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot
Specification
- Description:
- GPR110 Purified Mouse Polyclonal Antibody (B01P) is raised against a full-length human GPR110 protein (1 a.a. - 218 a.a.).
- Molecular Weight (kDa):
- 23.98 (Transfected lysate)
- Sequence:
- MKVGVLWLISFFTFTDGHGGFLGKNDGIKTKKELIVNKKKHLGPVEEYQLLLQVTYRDSKEKRDLRNFLKLLKPPLLWSHGLIRIIRAKATTDCNSLNGVLQCTCEDSYTWFPPSCLDPQNCYLHTAGALPSCECHLNNLSQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYANGIEIQLKKAYERIQGFESVQVTQFRMSLLSPKLECNGTI
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- GPR110
- Gene Description:
- GPR110 (G Protein-Coupled Receptor 110) is a protein coding gene, which encodes a receptor belonging to the adhesion-GPCR receptor family.
- GenBank Accession Number:
- NM_025048
- Protein Accession Number:
- NP_079324.2