Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Description:
• GPR135 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant GPR135 (391 a.a. - 493 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Molecular Weight (kDa):
• 37.44 (Immunogen)

• Sequence:
• NPNISMLLGRNREEGYRTRNVDAFLPSQGPGLQARSRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQPKSEAGDTS

• Storage Buffer:
• 50% glycerol

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• GPR135

• Gene Description:
• GPR135 (G Protein-Coupled Receptor 135) is a Protein Coding gene, which encodes an orphan receptor.

• GenBank Accession Number:
• NM_022571

• Protein Accession Number:
• NP_072093