GPR143 Mouse Polyclonal Antibody (B01)

GPR143 Mouse Polyclonal Antibody (B01)

For Research Use Only. Not For Clinical Use.

Catalog Number: PAB-M0067

Host: Mouse

Reactivity: Human

Product Size Price
50 μL Online Inquiry

Applications

  • Applications:
  • Flow Cytometry, Western Blot

Specification

  • Description:
  • GPR143 Mouse Polyclonal Antibody (B01) is raised against a full-length human GPR143 protein (1 a.a. - 424 a.a.).
  • Molecular Weight (kDa):
  • 46.64 (Transfected lysate)
  • Sequence:
  • MTQAGRRGPGTPEPRPRTQPMASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL
  • Storage Buffer:
  • No additive
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • GPR143
  • Gene Description:
  • GPR143 (G Protein-Coupled Receptor 143) is a Protein Coding gene. This gene encodes a protein that binds to heterotrimeric G proteins and is targeted to melanosomes in pigment cells. This protein is thought to be involved in intracellular signal transduction mechanisms. Mutations in this gene cause ocular albinism type 1, also referred to as Nettleship-Falls type ocular albinism, a severe visual disorder. A related pseudogene has been identified on chromosome Y. [provided by RefSeq, Dec 2009]
  • GenBank Accession Number:
  • NM_000273
  • Protein Accession Number:
  • NP_000264