GPR3 Purified Mouse Polyclonal Antibody (B01P)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot
Specification
- Description:
- GPR3 Purified Mouse Polyclonal Antibody (B01P) is raised against a full-length human GPR3 protein (1 a.a. - 330 a.a.).
- Molecular Weight (kDa):
- 36.3 (Transfected lysate)
- Sequence:
- MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- GPR3
- Gene Description:
- GPR3 (G Protein-Coupled Receptor 3) is a Protein Coding gene. This gene is a member of the G protein-coupled receptor family and is found in the cell membrane. G protein-coupled receptors, characterized by a seven transmembrane domain motif, are involved in translating outside signals into G protein mediated intracellular effects. The encoded protein activates adenylate cyclase and modulates amyloid-beta production in a mouse model, suggesting that it may play a role in Alzheimer's disease. [provided by RefSeq, Oct 2012]
- GenBank Accession Number:
- NM_005281
- Protein Accession Number:
- NP_005272.1