Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Description:
• GPR37L1 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant GPR37L1 (27 a.a. - 130 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Molecular Weight (kDa):
• 37.55 (Immunogen)

• Sequence:
• PLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATSPNPDKDGGTPDSGQELRGNLTGAPGQRLQIQNPLYPVTESSYSA

• Storage Buffer:
• 50% glycerol

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• GPR37L1

• Gene Description:
• GPR37L1 (G Protein-Coupled Receptor 37 Like 1) is a Protein Coding gene, which encodes a G-protein coupled receptor. It participates in the regulation of postnatal cerebellar development.

• GenBank Accession Number:
• NM_004767

• Protein Accession Number:
• NP_004758