Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Description:
• GPR62 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant GPR62 (314 a.a. - 368 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Molecular Weight (kDa):
• 32.16 (Immunogen)

• Sequence:
• RACTPQAWHPRALLQCLQRPPEGPAVGPSEAPEQTPELAGGRSPAYQGPPESSLS

• Storage Buffer:
• 50% glycerol

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• GPR62

• Gene Description:
• GPR62 (G Protein-Coupled Receptor 62) is a Protein Coding gene, which encodes an orphan G-protein coupled receptor. It has spontaneous activity for beta-arrestin recruitment (PubMed:28827538).

• GenBank Accession Number:
• NM_080865

• Protein Accession Number:
• NP_543141