Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Description:
• GPR84 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant GPR84 (208 a.a. - 316 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Molecular Weight (kDa):
• 38.1 (Immunogen)

• Sequence:
• AAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGK

• Storage Buffer:
• 50% glycerol

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• GPR84

• Gene Description:
• GPR84 (G Protein-Coupled Receptor 84) is a protein coding gene, which encodes the receptor for medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. It may involved in the process from fatty acid metabolism to regulation of the immune system.

• GenBank Accession Number:
• NM_020370

• Protein Accession Number:
• NP_065103