GPRC5A Purified Mouse Polyclonal Antibody (B01P)

GPRC5A Purified Mouse Polyclonal Antibody (B01P)

For Research Use Only. Not For Clinical Use.

Catalog Number: PAB-M0093

Host: Mouse

Reactivity: Human

Product Size Price
50 μg Online Inquiry

Applications

  • Applications:
  • Western Blot

Specification

  • Description:
  • GPRC5A Purified Mouse Polyclonal Antibody (B01P) is raised against a full-length human GPRC5A protein (1 a.a. - 357 a.a.).
  • Molecular Weight (kDa):
  • 39.27 (Transfected lysate)
  • Sequence:
  • MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
  • Storage Buffer:
  • In 1× PBS, pH 7.4
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • GPRC5A
  • Gene Description:
  • GPRC5A (G Protein-Coupled Receptor Class C Group 5 Member A) is a Protein Coding gene. This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation. [provided by RefSeq, Jul 2008]
  • GenBank Accession Number:
  • NM_003979
  • Protein Accession Number:
  • NP_003970.1