GPRC5D Mouse Polyclonal Antibody (A01)

GPRC5D Mouse Polyclonal Antibody (A01)

For Research Use Only. Not For Clinical Use.

Catalog Number: PAB-M0095

Host: Mouse

Reactivity: Human

Product Size Price
50 μL Online Inquiry

Applications

  • Applications:
  • Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

  • Description:
  • GPRC5D Mouse Polyclonal Antibody (A01) is raised against a partial recombinant GPRC5D (261 a.a. - 345 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
  • Molecular Weight (kDa):
  • 35.46 (Immunogen)
  • Sequence:
  • ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV
  • Storage Buffer:
  • 50% glycerol
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • GPRC5D
  • Gene Description:
  • GPRC5D (G Protein-Coupled Receptor Class C Group 5 Member D) is a protein coding gene. The protein encoded by this gene is a member of the G protein-coupled receptor family; however, the specific function of this gene has not yet been determined. [provided by RefSeq, Jul 2008]
  • GenBank Accession Number:
  • NM_018654
  • Protein Accession Number:
  • NP_061124