HTR1A Mouse Polyclonal Antibody (A01)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Enzyme-Linked Immunoabsorbent Assay
Specification
- Description:
- HTR1A Mouse Polyclonal Antibody (A01) is raised against a partial recombinant HTR1A (1 a.a. - 36 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Molecular Weight (kDa):
- 30.07 (Immunogen)
- Sequence:
- MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQ
- Storage Buffer:
- 50% glycerol
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- HTR1A
- Gene Description:
- HTR1A (5-Hydroxytryptamine Receptor 1A) is a Protein Coding gene. This gene encodes a G protein-coupled receptor for 5-hydroxytryptamine (serotonin), and belongs to the 5-hydroxytryptamine receptor subfamily. Serotonin has been implicated in a number of physiologic processes and pathologic conditions. Inactivation of this gene in mice results in behavior consistent with an increased anxiety and stress response. Mutation in the promoter of this gene has been associated with menstrual cycle-dependent periodic fevers. [provided by RefSeq, Jun 2012]
- GenBank Accession Number:
- NM_000524
- Protein Accession Number:
- NP_000515