Applications

• Applications:
• Western Blot

Specification

• Description:
• HTR1E Mouse Polyclonal Antibody (B01) is raised against a full-length human HTR1E protein (1 a.a. - 365 a.a.).

• Molecular Weight (kDa):
• 40.26 (Transfected lysate）

• Sequence:
• MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT

• Storage Buffer:
• No additive

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• HTR1E

• Gene Description:
• HTR1E (5-Hydroxytryptamine Receptor 1E) is a protein coding gene. It is specifically expressed in the human hippocampus and frontal cortex. The receptor has the ability to identify any mutation in neurologic and psychiatric diseases.

• GenBank Accession Number:
• NM_000865

• Protein Accession Number:
• NP_000856