Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Description:
• HTR1F Mouse Polyclonal Antibody (A01) is raised against a partial recombinant HTR1F (203 a.a. - 279 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Molecular Weight (kDa):
• 34.58 (Immunogen)

• Sequence:
• KIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWR

• Storage Buffer:
• 50% glycerol

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• HTR1F

• Gene Description:
• HTR1F (5-Hydroxytryptamine Receptor 1F) is a Protein Coding gene, which encodes a G-protein coupled receptor for 5-hydroxytryptamine (serotonin). It also acts as a receptor for various alkaloids and psychoactive substances.

• GenBank Accession Number:
• NM_000866

• Protein Accession Number:
• NP_000857