LGR7 Mouse Polyclonal Antibody (A01)

LGR7 Mouse Polyclonal Antibody (A01)

For Research Use Only. Not For Clinical Use.

Catalog Number: PAB-M0114

Host: Mouse

Reactivity: Human

Product Size Price
50 μL Online Inquiry

Applications

  • Applications:
  • Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

  • Description:
  • LGR7 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant LGR7 (68 a.a. - 162 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
  • Molecular Weight (kDa):
  • 36.56 (Immunogen)
  • Sequence:
  • WSMQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETNLRAVPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKI
  • Storage Buffer:
  • 50% glycerol
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • LGR7
  • Gene Description:
  • LGR7 (Leucine-Rich Repeat-Containing G Protein-Coupled Receptor 7) is a protein coding gene. This gene encodes a member of the leucine-rich repeat-containing subgroup of the G protein-coupled 7-transmembrane receptor superfamily. The encoded protein plays a critical role in sperm motility, pregnancy and parturition as a receptor for the protein hormone relaxin. Decreased expression of this gene may play a role in endometriosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]
  • GenBank Accession Number:
  • NM_021634
  • Protein Accession Number:
  • NP_067647