MRGPRF Mouse Polyclonal Antibody (B01)

MRGPRF Mouse Polyclonal Antibody (B01)

For Research Use Only. Not For Clinical Use.

Catalog Number: PAB-M0118

Host: Mouse

Reactivity: Human

Product Size Price
50 μL Online Inquiry

Applications

  • Applications:
  • Western Blot

Specification

  • Description:
  • MRGPRF Mouse Polyclonal Antibody (B01) is raised against a full-length human MRGPRF protein (1 a.a. - 343 a.a.).
  • Molecular Weight (kDa):
  • 37.84 (Transfected lysate)
  • Sequence:
  • MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFGFSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAERCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIFLGILLFLLCCPLMVLPCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPIVYFLAGRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS
  • Storage Buffer:
  • No additive
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • MRGPRF
  • Gene Description:
  • MRGPRF (MAS Related GPR Family Member F) is a Protein Coding gene, which encodes an orphan receptor. It may be involved in the regulation of nociceptor function.
  • GenBank Accession Number:
  • BC016964
  • Protein Accession Number:
  • AAH16964