MRGPRF Mouse Polyclonal Antibody (B01)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot
Specification
- Description:
- MRGPRF Mouse Polyclonal Antibody (B01) is raised against a full-length human MRGPRF protein (1 a.a. - 343 a.a.).
- Molecular Weight (kDa):
- 37.84 (Transfected lysate)
- Sequence:
- MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFGFSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAERCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIFLGILLFLLCCPLMVLPCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPIVYFLAGRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS
- Storage Buffer:
- No additive
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- MRGPRF
- Gene Description:
- MRGPRF (MAS Related GPR Family Member F) is a Protein Coding gene, which encodes an orphan receptor. It may be involved in the regulation of nociceptor function.
- GenBank Accession Number:
- BC016964
- Protein Accession Number:
- AAH16964