Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Description:
• NMUR1 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant NMUR1 (2 a.a. - 68 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Molecular Weight (kDa):
• 33.48 (Immunogen)

• Sequence:
• TPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMPICATYL

• Storage Buffer:
• 50% glycerol

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• NMUR1

• Gene Description:
• NMUR1 (Neuromedin U Receptor 1) is a Protein Coding gene, which encodes a receptor for the neuromedin-U and neuromedin-S neuropeptides.

• GenBank Accession Number:
• NM_006056

• Protein Accession Number:
• NP_006047