OR12D3 Mouse Polyclonal Antibody (B01)

OR12D3 Mouse Polyclonal Antibody (B01)

For Research Use Only. Not For Clinical Use.

Catalog Number: PAB-M0127

Host: Mouse

Reactivity: Human

Product Size Price
50 μL Online Inquiry

Applications

  • Applications:
  • Western Blot

Specification

  • Description:
  • OR12D3 Mouse Polyclonal Antibody (B01) is raised against a full-length human OR12D3 protein (1 a.a. - 316 a.a.).
  • Molecular Weight (kDa):
  • 34.76 (Transfected lysate)
  • Sequence:
  • MENVTTMNEFLLLGLTGVQELQPFFFGIFLIIYLINLIGNGSILVMVVLEPQLHSPMYFFLGNLSCLDISYSSVTLPKLLVNLVCSRRAISFLGCITQLHFFHFLGSTEAILLAIMAFDRFVAICNPLRYTVIMNPQVCILLAAAAWLISFFYALMHSVMTAHLSFCGSQKLNHFFYDVKPLLELACSDTLLNQWLLSIVTGSISMGAFFLTLLSCFYVIGFLLFKNRSCRILHKALSTCASHFMVVCLFYGPVGFTYIRPASATSMIQDRIMAIMYSAVTPVLNPLIYTLRNKEVMMALKKIFGRKLFKDWQQHH
  • Storage Buffer:
  • No additive
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • OR12D3
  • Gene Description:
  • OR12D3 (Olfactory Receptor Family 12 Subfamily D Member 3) is a Protein Coding gene. Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]
  • GenBank Accession Number:
  • NM_030959.2
  • Protein Accession Number:
  • NP_112221.1