PTGER4 Mouse Polyclonal Antibody (A01)

PTGER4 Mouse Polyclonal Antibody (A01)

For Research Use Only. Not For Clinical Use.

Catalog Number: PAB-M0141

Host: Mouse

Reactivity: Human

Product Size Price
50 μL Online Inquiry

Applications

  • Applications:
  • Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

  • Description:
  • PTGER4 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant PTGER4 (379 a.a. - 488 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
  • Molecular Weight (kDa):
  • 38.21 (Immunogen)
  • Sequence:
  • SFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPGMGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI
  • Storage Buffer:
  • 50% glycerol
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • PTGER4
  • Gene Description:
  • PTGER4 (Prostaglandin E Receptor 4) is a Protein Coding gene. The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 induced expression of early growth response 1 (EGR1), regulate the level and stability of cyclooxygenase-2 mRNA, and lead to the phosphorylation of glycogen synthase kinase-3. Knockout studies in mice suggest that this receptor may be involved in the neonatal adaptation of circulatory system, osteoporosis, as well as initiation of skin immune responses. [provided by RefSeq, Jul 2008]
  • GenBank Accession Number:
  • NM_000958
  • Protein Accession Number:
  • NP_000949