PTHR1 Mouse Polyclonal Antibody (A02)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Enzyme-Linked Immunoabsorbent Assay
Specification
- Description:
- PTHR1 Mouse Polyclonal Antibody (A02) is raised against a partial recombinant PTHR1 (27 a.a. - 134 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Molecular Weight (kDa):
- 37.99 (Immunogen)
- Sequence:
- DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDY
- Storage Buffer:
- 50% glycerol
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- PTH1R
- Gene Description:
- PTH1R (Parathyroid Hormone 1 Receptor) is a Protein Coding gene. The protein encoded by this gene is a member of the G-protein coupled receptor family 2. This protein is a receptor for parathyroid hormone (PTH) and for parathyroid hormone-like hormone (PTHLH). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system. Defects in this receptor are known to be the cause of Jansen's metaphyseal chondrodysplasia (JMC), chondrodysplasia Blomstrand type (BOCD), as well as enchodromatosis. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, May 2010]
- GenBank Accession Number:
- NM_000316
- Protein Accession Number:
- NP_000307