Applications

• Applications:
• Western Blot

Specification

• Description:
• TMEM11 Purified Mouse Polyclonal Antibody (B01P) is raised against a full-length human TMEM11 protein (1 a.a. - 192 a.a.).

• Molecular Weight (kDa):
• 21.5 (Transfected lysate)

• Concentration:
• The function of putative receptor protein is unknown.

• Sequence:
• MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAV

• Purification:
• transmembrane protein 11

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• TMEM11

• Gene Description:
• TMEM11 (Transmembrane Protein 11) is a Protein Coding gene. It is involved in mitochondrial morphogenesis.

• GenBank Accession Number:
• NM_003876.1

• Protein Accession Number:
• NP_003867.1