CCR9 Purified Rabbit Polyclonal Antibody (D01P)

CCR9 Purified Rabbit Polyclonal Antibody (D01P)

For Research Use Only. Not For Clinical Use.

Catalog Number: PAB-R0058

Host: Rabbit

Reactivity: Human

Product Size Price
100 μg Online Inquiry

Applications

  • Applications:
  • Western Blot

Specification

  • Description:
  • CCR9 Purified Rabbit Polyclonal Antibody (D01P) is raised against a full-length human CCR9 protein (1 a.a. -369 a.a.).
  • Molecular Weight (kDa):
  • 42 (Transfected lysate)
  • Sequence:
  • MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
  • Storage Buffer:
  • In 1× PBS, pH 7.4
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • CCR9
  • Gene Description:
  • CCR9 (C-C Motif Chemokine Receptor 9) is a Protein Coding gene. The protein encoded by this gene is a member of the beta chemokine receptor family. It is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are key regulators of the thymocytes migration and maturation in normal and inflammation conditions. The specific ligand of this receptor is CCL25. It has been found that this gene is differentially expressed by T lymphocytes of small intestine and colon, suggested a role in the thymocytes recruitment and development that may permit functional specialization of immune responses in different segment of the gastrointestinal tract. This gene is mapped to the chemokine receptor gene cluster region. Two alternatively spliced transcript variants have been described. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
  • GenBank Accession Number:
  • NM_031200
  • Protein Accession Number:
  • NP_112477.1