CXCR6 Purified Rabbit Polyclonal Antibody (D01P)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot
Specification
- Description:
- CXCR6 Purified Rabbit Polyclonal Antibody (D01P) is raised against a full-length human CXCR6 protein (1 a.a. -342 a.a.).
- Molecular Weight (kDa):
- 39.3 (Transfected lysate)
- Sequence:
- MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- CXCR6
- Gene Description:
- CXCR6 (C-X-C Motif Chemokine Receptor 6) is a Protein Coding gene, which encodes the receptor for the C-X-C chemokine CXCL16. CXCR6 is involved in the infection of HIV and SIV.
- GenBank Accession Number:
- NM_006564
- Protein Accession Number:
- NP_006555.1