Applications

• Applications:
• Western Blot

Specification

• Description:
• FPR2 Purified Rabbit Polyclonal Antibody (D01P) is raised against a full-length human FPR2 protein (1 a.a. -351 a.a.).

• Molecular Weight (kDa):
• 39 (Transfected lysate)

• Sequence:
• METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• FPR2

• Gene Description:
• FPR2 (Formyl Peptide Receptor 2) is a protein coding gene. The Formyl-peptide receptor-2 (FPR2) is a seven transmembrane G protein-coupled receptor. It is involved in antibacterial host defence and inflammation.

• GenBank Accession Number:
• NM_001005738

• Protein Accession Number:
• NP_001005738.1