FPR2 Rabbit Polyclonal Antibody (D01)

FPR2 Rabbit Polyclonal Antibody (D01)

For Research Use Only. Not For Clinical Use.

Catalog Number: PAB-R0119

Host: Rabbit

Reactivity: Human

Product Size Price
100 μL Online Inquiry

Applications

  • Applications:
  • Western Blot

Specification

  • Description:
  • FPR2 Rabbit Polyclonal Antibody (D01) is raised against a full-length human FPR2 protein (1 a.a.- 351 a.a.).
  • Molecular Weight (kDa):
  • 39 (Transfected lysate)
  • Sequence:
  • METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
  • Storage Buffer:
  • No additive
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • FPR2
  • Gene Description:
  • FPR2 (Formyl Peptide Receptor 2) is a protein coding gene. The Formyl-peptide receptor-2 (FPR2) is a seven transmembrane G protein-coupled receptor. It is involved in antibacterial host defence and inflammation.
  • GenBank Accession Number:
  • NM_001005738
  • Protein Accession Number:
  • NP_001005738.1