FPR2 Rabbit Polyclonal Antibody (D01)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot
Specification
- Description:
- FPR2 Rabbit Polyclonal Antibody (D01) is raised against a full-length human FPR2 protein (1 a.a.- 351 a.a.).
- Molecular Weight (kDa):
- 39 (Transfected lysate)
- Sequence:
- METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
- Storage Buffer:
- No additive
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- FPR2
- Gene Description:
- FPR2 (Formyl Peptide Receptor 2) is a protein coding gene. The Formyl-peptide receptor-2 (FPR2) is a seven transmembrane G protein-coupled receptor. It is involved in antibacterial host defence and inflammation.
- GenBank Accession Number:
- NM_001005738
- Protein Accession Number:
- NP_001005738.1