Applications

• Applications:
• Immunofluorescence (1-4 μg/mL)

Specification

• Description:
• FZD4 Rabbit Polyclonal Antibody is raised against partial recombiant protein corresponding to human FZD4.

• Isotype:
• IgG

• Form:
• Liquid

• Sequence:
• PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA

• Purification:
• Antigen affinity purification

• Storage Buffer:
• In PBS, pH 7.2 (40% glycerol, 0.02% Sodium Azide).

• Storage:
• Short term storage: 4°C.
  Long term storage: -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• FZD4

• Gene Description:
• FZD4 (Frizzled Class Receptor 4) is a protein coding gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. [provided by RefSeq, Jul 2008]

• Protein Accession Number:
• Q9ULV1