GPR61 Rabbit Polyclonal Antibody
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Immunohistochemistry (1:50-1:200)
Specification
- Description:
- GPR61 Rabbit Polyclonal Antibody is raised against partial recombinant protein corresponding to human GPR61.
- Isotype:
- IgG
- Form:
- Liquid
- Sequence:
- QFVCFFKPAPEEELRLPSREGSIEENFLQFLQGTGCPSESWVSRPLPSPKQEPPAVDFRIPGQIAEETSEFLEQQLTSDIIMSDSYLRPAASPRLES
- Purification:
- Antigen affinity purification
- Storage Buffer:
- In PBS, pH 7.2 (40% glycerol, 0.02% Sodium Azide).
- Storage:
-
Short term storage: 4°C.
Long term storage: -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- GPR61
- Gene Description:
- GPR61 (G Protein-Coupled Receptor 61) is a Protein Coding gene. This gene belongs to the G-protein coupled receptor 1 family. G protein-coupled receptors contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. The protein encoded by this gene is most closely related to biogenic amine receptors. [provided by RefSeq, Jul 2008]
- Protein Accession Number:
- Q9BZJ8