GPR61 Rabbit Polyclonal Antibody

GPR61 Rabbit Polyclonal Antibody

For Research Use Only. Not For Clinical Use.

Catalog Number: PAB-R0194

Host: Rabbit

Reactivity: Human

Product Size Price
100 μL Online Inquiry

Applications

  • Applications:
  • Immunohistochemistry (1:50-1:200)

Specification

  • Description:
  • GPR61 Rabbit Polyclonal Antibody is raised against partial recombinant protein corresponding to human GPR61.
  • Isotype:
  • IgG
  • Form:
  • Liquid
  • Sequence:
  • QFVCFFKPAPEEELRLPSREGSIEENFLQFLQGTGCPSESWVSRPLPSPKQEPPAVDFRIPGQIAEETSEFLEQQLTSDIIMSDSYLRPAASPRLES
  • Purification:
  • Antigen affinity purification
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% Sodium Azide).
  • Storage:
  • Short term storage: 4°C.
    Long term storage: -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • GPR61
  • Gene Description:
  • GPR61 (G Protein-Coupled Receptor 61) is a Protein Coding gene. This gene belongs to the G-protein coupled receptor 1 family. G protein-coupled receptors contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. The protein encoded by this gene is most closely related to biogenic amine receptors. [provided by RefSeq, Jul 2008]
  • Protein Accession Number:
  • Q9BZJ8