Applications

• Applications:
• Immunohistochemistry (1:20-1:50)

Specification

• Description:
• GPR61 Rabbit Polyclonal Antibody is raised against partial recombinant protein corresponding to human GPR61.

• Isotype:
• IgG

• Form:
• Liquid

• Sequence:
• SMFRVARVAAMQHGPLPTWMETPRQRSESLSSRSTMVTSSGAPQTTPHRTFGGGKAAVV

• Purification:
• Antigen affinity purification

• Storage Buffer:
• In PBS, pH 7.2 (40% glycerol, 0.02% Sodium Azide).

• Storage:
• Short term storage: 4°C.
  Long term storage: -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• GPR61

• Gene Description:
• GPR61 (G Protein-Coupled Receptor 61) is a Protein Coding gene. This gene belongs to the G-protein coupled receptor 1 family. G protein-coupled receptors contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. The protein encoded by this gene is most closely related to biogenic amine receptors. [provided by RefSeq, Jul 2008]

• Protein Accession Number:
• Q9BZJ8