MCHR1 Purified Rabbit Polyclonal Antibody (D01P)

MCHR1 Purified Rabbit Polyclonal Antibody (D01P)

For Research Use Only. Not For Clinical Use.

Catalog Number: PAB-R0248

Host: Rabbit

Reactivity: Human

Product Size Price
100 μg Online Inquiry

Applications

  • Applications:
  • Western Blot

Specification

  • Description:
  • MCHR1 Purified Rabbit Polyclonal Antibody (D01P) is raised against a full-length human MCHR1 protein (1 a.a. - 422 a.a.).
  • Molecular Weight (kDa):
  • 46 (Transfected lysate)
  • Sequence:
  • MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT
  • Storage Buffer:
  • In 1× PBS, pH 7.4
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • MCHR1
  • Gene Description:
  • MCHR1 (Melanin Concentrating Hormone Receptor 1) is a protein coding gene. The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin. [provided by RefSeq, Jul 2008]
  • GenBank Accession Number:
  • BC021146
  • Protein Accession Number:
  • AAH21146.1