Applications

• Applications:
• Western Blot

Specification

• Description:
• SAA2 Purified Rabbit Polyclonal Antibody (D01P) is raised against a full-length human SAA2 protein (1 a.a. - 122 a.a.)\.

• Molecular Weight (kDa):
• 13.5 (Transfected lysate)

• Sequence:
• MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• SAA2

• Gene Description:
• SAA2 (Serum Amyloid A2) is a Protein Coding gene. It is associated with several diseases, such as Amyloidosis and Amyloidosis Aa.

• GenBank Accession Number:
• NM_030754

• Protein Accession Number:
• NP_110381.1