FZD4 Human Recombinant Protein (Q01)
For Research Use Only. Not For Clinical Use.
Catalog Number: Hum0005
Host: Wheat Germ (in vitro)
Product Size | Price |
---|---|
10 μg | Online Inquiry |
25 μg | Online Inquiry |
Applications
- Applications:
- Enzyme-Linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Prtein Array
Specification
- Description:
- FZD4 Human Recombinant Protein (Q01) is human FZD4 partial ORF (107 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.
- Molecular Weight (kDa):
- 36.74 (Theoretical)
- Sequence:
- TEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGY
- Purification:
- Glutathione Sepharose 4 Fast Flow
- Storage Buffer:
- 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
- Storage:
-
Store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- FZD4
- Gene Description:
- FZD4 (Frizzled Class Receptor 4) is a protein coding gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. [provided by RefSeq, Jul 2008]
- GenBank Accession Number:
- NM_012193
- Protein Accession Number:
- NP_036325