FZD4 Human Recombinant Protein (Q01)

FZD4 Human Recombinant Protein (Q01)

For Research Use Only. Not For Clinical Use.

Catalog Number: Hum0005

Host: Wheat Germ (in vitro)

Product Size Price
10 μg Online Inquiry
25 μg Online Inquiry

Applications

  • Applications:
  • Enzyme-Linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Prtein Array

Specification

  • Description:
  • FZD4 Human Recombinant Protein (Q01) is human FZD4 partial ORF (107 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.
  • Molecular Weight (kDa):
  • 36.74 (Theoretical)
  • Sequence:
  • TEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGY
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage:
  • Store at -80°C.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • FZD4
  • Gene Description:
  • FZD4 (Frizzled Class Receptor 4) is a protein coding gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. [provided by RefSeq, Jul 2008]
  • GenBank Accession Number:
  • NM_012193
  • Protein Accession Number:
  • NP_036325