Applications

• Applications:
• Enzyme-Linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Prtein Array

Specification

• Description:
• GPR81 Human Recombinant Protein (Q01) is human GPR81 partial ORF (247 a.a. - 346 a.a.) recombinant protein with GST tag at N-terminal.

• Molecular Weight (kDa):
• 36.63 (Theoretical)

• Sequence:
• VPSSACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPKQPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH

• Purification:
• Glutathione Sepharose 4 Fast Flow

• Storage Buffer:
• 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

• Storage:
• Store at -80°C.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• GPR81

• Gene Description:
• GPR81 (G Protein-Coupled Receptor 81) is a Protein Coding gene. G protein-coupled receptors (GPCRs, or GPRs), such as GPR81, contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.[supplied by OMIM, Feb 2005]

• GenBank Accession Number:
• NM_032554.3

• Protein Accession Number:
• NP_115943.1