Applications

• Applications:
• Enzyme-Linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Prtein Array

Specification

• Description:
• LGR6 Human Recombinant Protein (Q01) is human LGR6 partial ORF (403 a.a. - 496 a.a.) recombinant protein with GST-tag at N-terminal.

• Molecular Weight (kDa):
• 36.08 (Theoretical)

• Sequence:
• ALSQAFSKDSFPKLRILEVPYAYQCCPYGMCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQLEMEDSKPHPSVQCSPT

• Purification:
• Glutathione Sepharose 4 Fast Flow

• Storage Buffer:
• 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

• Storage:
• Store at -80°C.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• LGR6

• Gene Description:
• LGR6 (Leucine Rich Repeat Containing G Protein-Coupled Receptor 6) is a Protein Coding gene. This gene encodes a member of the leucine-rich repeat-containing subgroup of the G protein-coupled 7-transmembrane protein superfamily. The encoded protein is a glycoprotein hormone receptor with a large N-terminal extracellular domain that contains leucine-rich repeats important for the formation of a horseshoe-shaped interaction motif for ligand binding. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]

• GenBank Accession Number:
• NM_021636

• Protein Accession Number:
• NP_067649