OR51E1 Human Recombinant Protein (Q01)

OR51E1 Human Recombinant Protein (Q01)

For Research Use Only. Not For Clinical Use.

Catalog Number: Hum0024

Host: Wheat Germ (in vitro)

Product Size Price
10 μg Online Inquiry
25 μg Online Inquiry

Applications

  • Applications:
  • Enzyme-Linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Prtein Array

Specification

  • Description:
  • OR51E1 Human Recombinant Protein (Q01) is human OR51E1 partial ORF (201 a.a. - 300 a.a.) recombinant protein with GST tag at N-terminal.
  • Molecular Weight (kDa):
  • 36.63 (Theoretical)
  • Sequence:
  • GLIVIISAIGLDSLLISFSYLLILKTVLGLTREAQAKAFGTCVSHVCAVFIFYVPFIGLSMVHRFSKRRDSPLPVILANIYLLVPPVLNPIVYGVKTKEI
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage:
  • Store at -80°C.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • OR51E1
  • Gene Description:
  • OR51E1 (Olfactory Receptor Family 51 Subfamily E Member 1) is a Protein Coding gene. Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]
  • GenBank Accession Number:
  • NM_152430.2
  • Protein Accession Number:
  • NP_689643.1